PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10022806m
Common NameEUTSA_v10022806mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family ZF-HD
Protein Properties Length: 268aa    MW: 30419.2 Da    PI: 9.4171
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10022806mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer100.99.2e-3282137258
      ZF-HD_dimer   2 ekvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreve 58 
                      ++vrY+eC++NhAas Ggh+vDGCgEfm+s geegta++l CaAC+CHR+FHR+e +
  Thhalv10022806m  82 KSVRYRECQRNHAASSGGHVVDGCGEFMSS-GEEGTAESLLCAACDCHRSFHRKEID 137
                      579**************************9.999********************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257743.0E-3470146IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047708.9E-3084136IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015661.8E-2985136IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152326.66386135IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
SuperFamilySSF466892.26E-18196263IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.3E-28197264IPR009057Homeodomain-like
TIGRFAMsTIGR015659.0E-30203260IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 268 aa     Download sequence    Send to blast
MEVREKKDEK MEMERRKSSA NPQILDHRLP PYTYPQTSDK EKPTSKRNGS DPVPDPDLDT  60
SPISVAPVPR SYVRPRATSP SKSVRYRECQ RNHAASSGGH VVDGCGEFMS SGEEGTAESL  120
LCAACDCHRS FHRKEIDGMF VVKFNSLGHS QRPIVSRHVS PIMMSFGGGG GGRDPAESST  180
EDLNKLHQSF SGNGVDQFQY HPKKRFRTKF NQEQKEKMME FAEKIGWRLS KPEDEEVNRF  240
CREINVKRQV FKVWMHNNKQ AAKNKDM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A2e-202042621876ZF-HD homeobox family protein
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00268DAPTransfer from AT2G18350Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006409164.10.0hypothetical protein EUTSA_v10022806mg
SwissprotQ9ZPW71e-155ZHD6_ARATH; Zinc-finger homeodomain protein 6
TrEMBLV4M6J50.0V4M6J5_EUTSA; Uncharacterized protein
STRINGBra037224.1-P1e-166(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM65152543
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G18350.11e-140homeobox protein 24